SCOP 1.75: Domain d1d0eb_: 1d0e B:

Lineage for d1d0eb_ (1d0e B:)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein MMLV reverse transcriptase [56687] (1 species)

7. Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
   Uniprot P03355 RE 144-594

8. Domain d1d0eb_: 1d0e B: [43022]
   fragment of "palm" and "fingers" domains
   protein/DNA complex

Details for d1d0eb_

PDB Entry: 1d0e, 3 Å

PDB Description: crystal structures of the n-terminal fragment from moloney murine leukemia virus reverse transcriptase complexed with nucleic acid: functional implications for template-primer binding to the fingers domain

PDB Compounds: (B:) reverse transcriptase

SCOP Domain Sequences for d1d0eb_:

Sequence; same for both SEQRES and ATOM records:

>d1d0eb_ e.8.1.2 (B:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
hmtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrl
ldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglpp
shqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfde
alhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqi
cqkqvkylgyllkegqr

Timeline for d1d0eb_:

• d1d0eb_ first appeared (with stable ids) in SCOP 1.55
  
• d1d0eb_ appears in SCOP 1.73
  
• d1d0eb_ appears in SCOPe 2.01
  
• d1d0eb_ appears in the current release, SCOPe 2.08