Lineage for d1d0eb_ (1d0e B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571504Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 2571893Protein MMLV reverse transcriptase [56687] (1 species)
  7. 2571894Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
    Uniprot P03355 RE 144-594
  8. 2571918Domain d1d0eb_: 1d0e B: [43022]
    fragment of "palm" and "fingers" domains
    protein/DNA complex

Details for d1d0eb_

PDB Entry: 1d0e (more details), 3 Å

PDB Description: crystal structures of the n-terminal fragment from moloney murine leukemia virus reverse transcriptase complexed with nucleic acid: functional implications for template-primer binding to the fingers domain
PDB Compounds: (B:) reverse transcriptase

SCOPe Domain Sequences for d1d0eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0eb_ e.8.1.2 (B:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
hmtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrl
ldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglpp
shqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfde
alhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqi
cqkqvkylgyllkegqr

SCOPe Domain Coordinates for d1d0eb_:

Click to download the PDB-style file with coordinates for d1d0eb_.
(The format of our PDB-style files is described here.)

Timeline for d1d0eb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d0ea_