Lineage for d1d0ea_ (1d0e A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055706Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1055707Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1055873Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 1056112Protein MMLV reverse transcriptase [56687] (1 species)
  7. 1056113Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
    Uniprot P03355 RE 144-594
  8. 1056136Domain d1d0ea_: 1d0e A: [43021]
    fragment of "palm" and "fingers" domains
    protein/DNA complex

Details for d1d0ea_

PDB Entry: 1d0e (more details), 3 Å

PDB Description: crystal structures of the n-terminal fragment from moloney murine leukemia virus reverse transcriptase complexed with nucleic acid: functional implications for template-primer binding to the fingers domain
PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1d0ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ea_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
gshmtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiq
rlldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsgl
ppshqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlf
dealhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakka
qicqkqvkylgyllkegqr

SCOPe Domain Coordinates for d1d0ea_:

Click to download the PDB-style file with coordinates for d1d0ea_.
(The format of our PDB-style files is described here.)

Timeline for d1d0ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d0eb_