Lineage for d1d0ea_ (1d0e A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339256Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 339257Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 339321Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 339460Protein MMLV reverse transcriptase [56687] (1 species)
  7. 339461Species Moloney murine leukaemia virus, MoMLV [56688] (7 PDB entries)
  8. 339470Domain d1d0ea_: 1d0e A: [43021]

Details for d1d0ea_

PDB Entry: 1d0e (more details), 3 Å

PDB Description: crystal structures of the n-terminal fragment from moloney murine leukemia virus reverse transcriptase complexed with nucleic acid: functional implications for template-primer binding to the fingers domain

SCOP Domain Sequences for d1d0ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ea_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukaemia virus, MoMLV}
gshmtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiq
rlldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsgl
ppshqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlf
dealhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakka
qicqkqvkylgyllkegqr

SCOP Domain Coordinates for d1d0ea_:

Click to download the PDB-style file with coordinates for d1d0ea_.
(The format of our PDB-style files is described here.)

Timeline for d1d0ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1d0eb_