Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (2 proteins) |
Protein MMLV reverse transcriptase [56687] (1 species) |
Species Moloney murine leukaemia virus, MoMLV [56688] (7 PDB entries) |
Domain d1d0ea_: 1d0e A: [43021] |
PDB Entry: 1d0e (more details), 3 Å
SCOP Domain Sequences for d1d0ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0ea_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukaemia virus, MoMLV} gshmtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiq rlldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsgl ppshqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlf dealhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakka qicqkqvkylgyllkegqr
Timeline for d1d0ea_: