Lineage for d1qaja_ (1qaj A:)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618312Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)
  6. 618491Protein MMLV reverse transcriptase [56687] (1 species)
  7. 618492Species Moloney murine leukaemia virus, MoMLV [56688] (9 PDB entries)
  8. 618497Domain d1qaja_: 1qaj A: [43016]

Details for d1qaja_

PDB Entry: 1qaj (more details), 2.3 Å

PDB Description: crystal structures of the n-terminal fragment from moloney murine leukemia virus reverse transcriptase complexed with nucleic acid: functional implications for template-primer binding to the fingers domain

SCOP Domain Sequences for d1qaja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qaja_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukaemia virus, MoMLV}
gshmtwlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiq
rlldqgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsgl
ppshqwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlf
dealhrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakka
qicqkqvkylgyllkegqr

SCOP Domain Coordinates for d1qaja_:

Click to download the PDB-style file with coordinates for d1qaja_.
(The format of our PDB-style files is described here.)

Timeline for d1qaja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qajb_