Lineage for d1d5aa2 (1d5a A:348-756)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424453Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 424510Protein Family B DNA polymerase [56680] (6 species)
  7. 424511Species Archaeon Desulfurococcus tok [TaxId:108142] [56684] (2 PDB entries)
  8. 424512Domain d1d5aa2: 1d5a A:348-756 [43012]
    Other proteins in same PDB: d1d5aa1
    complexed with mg, so4

Details for d1d5aa2

PDB Entry: 1d5a (more details), 2.4 Å

PDB Description: crystal structure of an archaebacterial dna polymerase d.tok. deposition of second native structure at 2.4 angstrom

SCOP Domain Sequences for d1d5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5aa2 e.8.1.1 (A:348-756) Family B DNA polymerase {Archaeon Desulfurococcus tok}
stgnlvewfllrkayerndvapnkpderelarrtesyaggyvkepekglwenivyldyks
lypsiiithnvspdtlnregcreydvapqvghrfckdfpgfipsllgdlleerqkvkkkm
katvdpierklldyrqraikilansyygyyayanarwycrecaesvtawgrqyiettmre
ieekfgfkvlyadtdgffatipgadaetvknkakeflnyinprlpglleleyegfyrrgf
fvtkkkyavideedkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevt
eklsrhevppeklviyeagphvaaaatvisyivlkgpgrvgdraipfdefdpakhrydae
yyienqvlpaverilrafgyrkedlr

SCOP Domain Coordinates for d1d5aa2:

Click to download the PDB-style file with coordinates for d1d5aa2.
(The format of our PDB-style files is described here.)

Timeline for d1d5aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d5aa1