Lineage for d1qhta2 (1qht A:348-750)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424451Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 424452Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 424453Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 424510Protein Family B DNA polymerase [56680] (6 species)
  7. 424518Species Archaeon Thermococcus sp., 9on-7 [TaxId:35749] [56683] (1 PDB entry)
  8. 424519Domain d1qhta2: 1qht A:348-750 [43011]
    Other proteins in same PDB: d1qhta1
    mutant

Details for d1qhta2

PDB Entry: 1qht (more details), 2.1 Å

PDB Description: dna polymerase from thermococcus sp. 9on-7 archaeon

SCOP Domain Sequences for d1qhta2:

Sequence, based on SEQRES records: (download)

>d1qhta2 e.8.1.1 (A:348-750) Family B DNA polymerase {Archaeon Thermococcus sp., 9on-7}
stgnlvewfllrkaykrnelapnkpderelarrrggyaggyvkeperglwdnivyldfrs
lypsiiithnvspdtlnregckeydvapevghkfckdfpgfipsllgdlleerqkikrkm
katvdplekklldyrqraikilansfygyygyakarwyckecaesvtawgreyiemvire
leekfgfkvlyadtdglhatipgadaetvkkkakeflkyinpklpglleleyegfyvrgf
fvtkkkyavideegkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevt
eklskyevppeklviheqitrdlrdykatgphvavakrlaargvkirpgtvisyivlkgs
grigdraipadefdptkhrydaeyyienqvlpaverilkafgy

Sequence, based on observed residues (ATOM records): (download)

>d1qhta2 e.8.1.1 (A:348-750) Family B DNA polymerase {Archaeon Thermococcus sp., 9on-7}
stgnlvewfllrkaykrnelapnkpderelarrrggyaggyvkeperglwdnivyldfrs
lypsiiithnvspdtlnregckeydvapevghkfckdfpgfipsllgdlleerqkikrkm
katvdplekklldyrqraikilansfygyygyakarwyckecaesvtawgreyiemvire
leekfgfkvlyadtdglhatipgadaetvkkkakeflkyinleleyegfyvrgffvtkkk
yavideegkittrgleivrrdwseiaketqarvleailkhgdveeavrivkevtlviheq
iatgphvavakrlaargvkirpgtvisyivlkgdraipadefeyyienqvlpaverilka
fgy

SCOP Domain Coordinates for d1qhta2:

Click to download the PDB-style file with coordinates for d1qhta2.
(The format of our PDB-style files is described here.)

Timeline for d1qhta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qhta1