SCOPe 2.01: Domain d1clqa2: 1clq A:376-903

Lineage for d1clqa2 (1clq A:376-903)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (4 proteins)

6. Protein Family B DNA polymerase [56680] (7 species)

7. Species Bacteriophage RB69 [TaxId:12353] [56681] (15 PDB entries)

8. Domain d1clqa2: 1clq A:376-903 [43006]
   Other proteins in same PDB: d1clqa1
   protein/DNA complex; complexed with ca, gdp

Details for d1clqa2

PDB Entry: 1clq, 2.7 Å

PDB Description: crystal structure of a replication fork dna polymerase editing complex at 2.7 a resolution

PDB Compounds: (A:) protein (DNA polymerase)

SCOPe Domain Sequences for d1clqa2:

Sequence; same for both SEQRES and ATOM records:

>d1clqa2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

Timeline for d1clqa2:

• d1clqa2 first appeared (with stable ids) in SCOP 1.55
  
• d1clqa2 appears in SCOP 1.75
  
• d1clqa2 appears in SCOPe 2.02
  
• d1clqa2 appears in the current release, SCOPe 2.08