Lineage for d1t7pa2 (1t7p A:211-704)

  1. Root: SCOP 1.71
  2. 617324Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)
  3. 618192Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 618193Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 618194Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 618294Protein T7 phage DNA polymerase [56678] (1 species)
  7. 618295Species Bacteriophage T7 [TaxId:10760] [56679] (15 PDB entries)
  8. 618298Domain d1t7pa2: 1t7p A:211-704 [43005]
    Other proteins in same PDB: d1t7pa1, d1t7pb_
    protein/DNA complex; complexed with 2da, dg3, mg; mutant

Details for d1t7pa2

PDB Entry: 1t7p (more details), 2.2 Å

PDB Description: t7 dna polymerase complexed to dna primer/template,a nucleoside triphosphate, and its processivity factor thioredoxin

SCOP Domain Sequences for d1t7pa2:

Sequence, based on SEQRES records: (download)

>d1t7pa2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkvggifkkpknkaqregrepceldtreyvagapytpve
hvvfnpssrdhiqkklqeagwvptkytdkgapvvddevlegvrvddpekqaaidlikeyl
miqkrigqsaegdkawlryvaedgkihgsvnpngavtgrathafpnlaqipgvrspygeq
craafgaehhldgitgkpwvqagidasglelrclahfmarfdngeyaheilngdihtknq
iaaelptrdnaktfiygflygagdekigqivgagkergkelkkkflentpaiaalresiq
qtlvessqwvageqqvkwkrrwikgldgrkvhvrsphaalntllqsagalicklwiikte
emlvekglkhgwdgdfaymawvhdeiqvgcrteeiaqvvietaqeamrwvgdhwnfrcll
dtegkmgpnwaich

Sequence, based on observed residues (ATOM records): (download)

>d1t7pa2 e.8.1.1 (A:211-704) T7 phage DNA polymerase {Bacteriophage T7}
leavdiehraawllakqerngfpfdtkaieelyvelaarrsellrkltetfgswyqpkgg
temfchprtgkplpkypriktpkeyvagapytpvehvvfnpssrdhiqkklqeagwvptk
ytdkgapvvddevlegvrvddpekqaaidlikeylmiqkrigqsaegdkawlryvaedgk
ihgsvnpngavtgrathafpnlaqipgvrspygeqcraafgaehhldgitgkpwvqagid
asglelrclahfmarfdngeyaheilngdihtknqiaaelptrdnaktfiygflygagde
kigqivgagkergkelkkkflentpaiaalresiqqtlvekwkrrwikgldgrkvhvrsp
haalntllqsagalicklwiikteemlvekglkhgwdgdfaymawvhdeiqvgcrteeia
qvvietaqeamrwvgdhwnfrclldtegkmgpnwaich

SCOP Domain Coordinates for d1t7pa2:

Click to download the PDB-style file with coordinates for d1t7pa2.
(The format of our PDB-style files is described here.)

Timeline for d1t7pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t7pa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1t7pb_