Lineage for d1taua4 (1tau A:423-832)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1951566Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 1951567Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 1951568Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 1951569Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 1951635Species Thermus aquaticus [TaxId:271] [56676] (26 PDB entries)
  8. 1951661Domain d1taua4: 1tau A:423-832 [43000]
    Other proteins in same PDB: d1taua1, d1taua2, d1taua3
    protein/DNA complex; complexed with bgl, zn

Details for d1taua4

PDB Entry: 1tau (more details), 3 Å

PDB Description: taq polymerase (e.c.2.7.7.7)/dna/b-octylglucoside complex
PDB Compounds: (A:) protein (taq polymerase)

SCOPe Domain Sequences for d1taua4:

Sequence, based on SEQRES records: (download)

>d1taua4 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

Sequence, based on observed residues (ATOM records): (download)

>d1taua4 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelstsaavlealreahpivekilqyreltklkstyidplpdlihpr
tgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaeegwllvaldysqiel
rvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraaktinfgvlygmsah
rlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvetlfgrrryvpdlear
vksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllqvhdelvleapkera
eavarlakevmegvyplavplevevgigedwlsake

SCOPe Domain Coordinates for d1taua4:

Click to download the PDB-style file with coordinates for d1taua4.
(The format of our PDB-style files is described here.)

Timeline for d1taua4: