Lineage for d1taua4 (1tau A:423-832)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38209Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 38210Superfamily e.8.1: DNA/RNA polymerases [56672] (4 families) (S)
  5. 38211Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 38212Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 38233Species Thermus aquaticus [TaxId:271] [56676] (13 PDB entries)
  8. Domain d1taua4: 1tau A:423-832 [43000]
    Other proteins in same PDB: d1taua1, d1taua2, d1taua3

Details for d1taua4

PDB Entry: 1tau (more details), 3 Å

PDB Description: taq polymerase (e.c.2.7.7.7)/dna/b-octylglucoside complex

SCOP Domain Sequences for d1taua4:

Sequence, based on SEQRES records: (download)

>d1taua4 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrgfiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

Sequence, based on observed residues (ATOM records): (download)

>d1taua4 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelstsaavlealreahpivekilqyreltklkstyidplpdlihpr
tgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrgfiaeegwllvaldysqiel
rvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraaktinfgvlygmsah
rlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvetlfgrrryvpdlear
vksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllqvhdelvleapkera
eavarlakevmegvyplavplevevgigedwlsake

SCOP Domain Coordinates for d1taua4 are not available.

Timeline for d1taua4:

Domains from same chain:
(mouse over for more information)
d1taua1, d1taua2, d1taua3