Lineage for d1jxe_2 (1jxe 423-832)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38209Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 38210Superfamily e.8.1: DNA/RNA polymerases [56672] (4 families) (S)
  5. 38211Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 38212Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 38233Species Thermus aquaticus [TaxId:271] [56676] (13 PDB entries)
  8. 38244Domain d1jxe_2: 1jxe 423-832 [42998]
    Other proteins in same PDB: d1jxe_1

Details for d1jxe_2

PDB Entry: 1jxe (more details), 2.85 Å

PDB Description: stoffel fragment of taq dna polymerase i

SCOP Domain Sequences for d1jxe_2:

Sequence, based on SEQRES records: (download)

>d1jxe_2 e.8.1.1 (423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

Sequence, based on observed residues (ATOM records): (download)

>d1jxe_2 e.8.1.1 (423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglaavlealreahpivekilqyreltklkstyidplpdlihprt
grlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaeegwllvaldysqielr
vlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraaktinfgvlygmsahr
lsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvetlfgrrryvpdlearv
ksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllqvhdelvleapkerae
avarlakevmegvyplavplevevgigedwlsake

SCOP Domain Coordinates for d1jxe_2:

Click to download the PDB-style file with coordinates for d1jxe_2.
(The format of our PDB-style files is described here.)

Timeline for d1jxe_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jxe_1