Lineage for d1bgxt4 (1bgx T:423-832)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2220074Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2220075Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2220076Family e.8.1.1: DNA polymerase I [56673] (5 protein domains)
  6. 2220077Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 2220143Species Thermus aquaticus [TaxId:271] [56676] (29 PDB entries)
  8. 2220160Domain d1bgxt4: 1bgx T:423-832 [42992]
    Other proteins in same PDB: d1bgxh1, d1bgxh2, d1bgxl1, d1bgxl2, d1bgxt1, d1bgxt2, d1bgxt3
    protein/DNA complex

Details for d1bgxt4

PDB Entry: 1bgx (more details), 2.3 Å

PDB Description: taq polymerase in complex with tp7, an inhibitory fab
PDB Compounds: (T:) taq DNA polymerase

SCOPe Domain Sequences for d1bgxt4:

Sequence, based on SEQRES records: (download)

>d1bgxt4 e.8.1.1 (T:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

Sequence, based on observed residues (ATOM records): (download)

>d1bgxt4 e.8.1.1 (T:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleaaeavarlakevmegvyplavplevevgigedwlsake

SCOPe Domain Coordinates for d1bgxt4:

Click to download the PDB-style file with coordinates for d1bgxt4.
(The format of our PDB-style files is described here.)

Timeline for d1bgxt4: