Lineage for d3ktqa2 (3ktq A:423-831)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884271Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 884272Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 884335Species Thermus aquaticus [TaxId:271] [56676] (13 PDB entries)
  8. 884342Domain d3ktqa2: 3ktq A:423-831 [42989]
    Other proteins in same PDB: d3ktqa1
    complexed with ctp, ddc, mg

Details for d3ktqa2

PDB Entry: 3ktq (more details), 2.3 Å

PDB Description: crystal structure of an active ternary complex of the large fragment of dna polymerase i from thermus aquaticus
PDB Compounds: (A:) protein (large fragment of DNA polymerase I)

SCOP Domain Sequences for d3ktqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ktqa2 e.8.1.1 (A:423-831) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsak

SCOP Domain Coordinates for d3ktqa2:

Click to download the PDB-style file with coordinates for d3ktqa2.
(The format of our PDB-style files is described here.)

Timeline for d3ktqa2: