Lineage for d1kfd_2 (1kfd 519-928)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517941Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 517942Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 517943Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 517944Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 517978Species Escherichia coli [TaxId:562] [56675] (14 PDB entries)
  8. 517992Domain d1kfd_2: 1kfd 519-928 [42987]
    Other proteins in same PDB: d1kfd_1

Details for d1kfd_2

PDB Entry: 1kfd (more details), 3.9 Å

PDB Description: crystal structures of the klenow fragment of dna polymerase i complexed with deoxynucleoside triphosphate and pyrophosphate

SCOP Domain Sequences for d1kfd_2:

Sequence, based on SEQRES records: (download)

>d1kfd_2 e.8.1.1 (519-928) DNA polymerase I (Klenow fragment) {Escherichia coli}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlsstkqlqtilfekqgikplkktpggapstseevleelaldyplpkvileyrglaklks
tytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiaped
yvivsadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsak
ainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetl
dgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmim
qvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah

Sequence, based on observed residues (ATOM records): (download)

>d1kfd_2 e.8.1.1 (519-928) DNA polymerase I (Klenow fragment) {Escherichia coli}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiadypl
pkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrn
eegrrirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfg
lpletvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleyme
rtraqakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiav
dawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgen
wdqah

SCOP Domain Coordinates for d1kfd_2:

Click to download the PDB-style file with coordinates for d1kfd_2.
(The format of our PDB-style files is described here.)

Timeline for d1kfd_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kfd_1