Lineage for d1klna2 (1kln A:519-928)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571155Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2571156Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 2571207Species Escherichia coli [TaxId:562] [56675] (14 PDB entries)
  8. 2571220Domain d1klna2: 1kln A:519-928 [42986]
    Other proteins in same PDB: d1klna1
    protein/DNA complex; complexed with zn; mutant

Details for d1klna2

PDB Entry: 1kln (more details), 3.2 Å

PDB Description: dna polymerase i klenow fragment (e.c.2.7.7.7) mutant/dna complex
PDB Compounds: (A:) protein (DNA polymerase I klenow fragment (e.c.2.7.7.7))

SCOPe Domain Sequences for d1klna2:

Sequence, based on SEQRES records: (download)

>d1klna2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli [TaxId: 562]}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlsstkqlqtilfekqgikplkktpggapstseevleelaldyplpkvileyrglaklks
tytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiaped
yvivsadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsak
ainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetl
dgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmim
qvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah

Sequence, based on observed residues (ATOM records): (download)

>d1klna2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli [TaxId: 562]}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlssqlqtilfekqgikplktseevleelaldyplpkvileyrglaklkstytdklplmi
npktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiapedyvivsadysq
ielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsakainfgliygm
safglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetldgrrlylpdi
kssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmimqvhdelvfev
hkddvdavakqihqlmenctrldvpllvevgsgenwdqah

SCOPe Domain Coordinates for d1klna2:

Click to download the PDB-style file with coordinates for d1klna2.
(The format of our PDB-style files is described here.)

Timeline for d1klna2: