Lineage for d1d9fa2 (1d9f A:519-928)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571155Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2571156Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 2571207Species Escherichia coli [TaxId:562] [56675] (14 PDB entries)
  8. 2571218Domain d1d9fa2: 1d9f A:519-928 [42984]
    Other proteins in same PDB: d1d9fa1
    protein/DNA complex; protein/RNA complex; complexed with so4, zn

Details for d1d9fa2

PDB Entry: 1d9f (more details), 3 Å

PDB Description: crystal structure of the complex of dna polymerase i klenow fragment with dna tetramer carrying 2'-o-(3-aminopropyl)-rna modification 5'-d(tt)-ap(u)-d(t)-3'
PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d1d9fa2:

Sequence, based on SEQRES records: (download)

>d1d9fa2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli [TaxId: 562]}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlsstkqlqtilfekqgikplkktpggapstseevleelaldyplpkvileyrglaklks
tytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiaped
yvivsadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsak
ainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetl
dgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmim
qvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah

Sequence, based on observed residues (ATOM records): (download)

>d1d9fa2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli [TaxId: 562]}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlsstkqlqtilfekqgikplkktpstseevleelaldyplpkvileyrglaklkstytd
klplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiapedyviv
sadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsakainf
gliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetldgrr
lylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmimqvhd
elvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah

SCOPe Domain Coordinates for d1d9fa2:

Click to download the PDB-style file with coordinates for d1d9fa2.
(The format of our PDB-style files is described here.)

Timeline for d1d9fa2: