Lineage for d2kzza2 (2kzz A:519-928)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38209Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
  4. 38210Superfamily e.8.1: DNA/RNA polymerases [56672] (4 families) (S)
  5. 38211Family e.8.1.1: DNA polymerase I [56673] (3 proteins)
  6. 38212Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 38218Species Escherichia coli [TaxId:562] [56675] (14 PDB entries)
  8. 38227Domain d2kzza2: 2kzz A:519-928 [42982]
    Other proteins in same PDB: d2kzza1

Details for d2kzza2

PDB Entry: 2kzz (more details), 2.25 Å

PDB Description: klenow fragment with normal substrate and zinc only
PDB Compounds: (A:) protein (DNA polymerase I)

SCOP Domain Sequences for d2kzza2:

Sequence, based on SEQRES records: (download)

>d2kzza2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlsstkqlqtilfekqgikplkktpggapstseevleelaldyplpkvileyrglaklks
tytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiaped
yvivsadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsak
ainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetl
dgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmim
qvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah

Sequence, based on observed residues (ATOM records): (download)

>d2kzza2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlsstkqlqtilfekqgikplkktpstseevleelaldyplpkvileyrglaklkstytd
klplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiapedyviv
sadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsakainf
gliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetldgrr
lylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmimqvhd
elvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah

SCOP Domain Coordinates for d2kzza2:

Click to download the PDB-style file with coordinates for d2kzza2.
(The format of our PDB-style files is described here.)

Timeline for d2kzza2: