Lineage for d1inp__ (1inp -)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) 
Fold e.7: Sugar phosphatases [56654] (1 superfamily) Superfamily e.7.1: Sugar phosphatases [56655] (1 family) 
Family e.7.1.1: Sugar phosphatases [56656] (5 proteins) 
Protein Inositol polyphosphate 1-phosphatase [56667] (1 species) Species Cow (Bos taurus), brain [TaxId:9913] [56668] (1 PDB entry) 
Domain d1inp__: 1inp - [42972]
Details for d1inp__
PDB Entry: 1inp (more details), 2.3 Å
PDB Description: crystal structure of inositol polyphosphate 1-phosphatase at 2.3 angstroms resolution
SCOP Domain Sequences for d1inp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1inp__ e.7.1.1 (-) Inositol polyphosphate 1-phosphatase {Cow (Bos taurus), brain}
msdilqellrvsekaaniaracrqqetlfqllieekkegeknkkfavdfktladvlvqev
ikenmenkfpglgkkifgeesneltndlgekiimrlgpteeetvallskvlngnklasea
lakvvhqdvffsdpaldsveinipqdilgiwvdpidstyqyikgsaditpnqgifpsglq
cvtvligvydiqtgvplmgvinqpfvsqdlhtrrwkgqcywglsylgtnihsllppvstr
snseaqsqgtqnpssegscrfsvvistseketikgalshvcgerifraagagykslcvil
gladiyifsedttfkwdscaahailramgggmvdlkeclernpdtgldlpqlvyhvgneg
aagvdqwankggliayrsekqletflsrllqhlapvatht
SCOP Domain Coordinates for d1inp__:
Click to download the PDB-style file with coordinates for d1inp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1inp__:
- d1inp__ appears in SCOP 1.57
- d1inp__ appears in the current release, SCOPe 2.08, called d1inpa_
View in 3D