SCOP 1.71: Domain d1imeb_: 1ime B:

Lineage for d1imeb_ (1ime B:)

1. Root: SCOP 1.71

2. Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)

3. Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
   N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet

4. Superfamily e.7.1: Carbohydrate phosphatase [56655] (2 families)

5. Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (6 proteins)

6. Protein Inositol monophosphatase [56663] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56664] (8 PDB entries)

8. Domain d1imeb_: 1ime B: [42960]
   complexed with ca

Details for d1imeb_

PDB Entry: 1ime, 2.25 Å

PDB Description: structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis

SCOP Domain Sequences for d1imeb_:

Sequence; same for both SEQRES and ATOM records:

>d1imeb_ e.7.1.1 (B:) Inositol monophosphatase {Human (Homo sapiens)}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdded

Timeline for d1imeb_:

• d1imeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1imeb_ appears in SCOP 1.69
  
• d1imeb_ appears in SCOP 1.73
  
• d1imeb_ appears in the current release, SCOPe 2.08