Lineage for d1imea_ (1ime A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1055431Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1055432Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1055433Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1055590Protein Inositol monophosphatase [56663] (1 species)
  7. 1055591Species Human (Homo sapiens) [TaxId:9606] [56664] (8 PDB entries)
  8. 1055598Domain d1imea_: 1ime A: [42959]
    complexed with ca

Details for d1imea_

PDB Entry: 1ime (more details), 2.25 Å

PDB Description: structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
PDB Compounds: (A:) inositol monophosphatase

SCOPe Domain Sequences for d1imea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imea_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdded

SCOPe Domain Coordinates for d1imea_:

Click to download the PDB-style file with coordinates for d1imea_.
(The format of our PDB-style files is described here.)

Timeline for d1imea_: