Lineage for d1imbb_ (1imb B:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86688Fold e.7: Sugar phosphatases [56654] (1 superfamily)
  4. 86689Superfamily e.7.1: Sugar phosphatases [56655] (1 family) (S)
  5. 86690Family e.7.1.1: Sugar phosphatases [56656] (6 proteins)
  6. 86790Protein Inositol monophosphatase [56663] (1 species)
  7. 86791Species Human (Homo sapiens) [TaxId:9606] [56664] (8 PDB entries)
  8. 86795Domain d1imbb_: 1imb B: [42958]

Details for d1imbb_

PDB Entry: 1imb (more details), 2.2 Å

PDB Description: structural analysis of inositol monophosphatase complexes with substrates

SCOP Domain Sequences for d1imbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imbb_ e.7.1.1 (B:) Inositol monophosphatase {Human (Homo sapiens)}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdded

SCOP Domain Coordinates for d1imbb_:

Click to download the PDB-style file with coordinates for d1imbb_.
(The format of our PDB-style files is described here.)

Timeline for d1imbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1imba_