Lineage for d2hhma_ (2hhm A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339094Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 339095Superfamily e.7.1: Carbohydrate phosphatase [56655] (2 families) (S)
  5. 339096Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (6 proteins)
  6. 339229Protein Inositol monophosphatase [56663] (1 species)
  7. 339230Species Human (Homo sapiens) [TaxId:9606] [56664] (8 PDB entries)
  8. 339231Domain d2hhma_: 2hhm A: [42955]

Details for d2hhma_

PDB Entry: 2hhm (more details), 2.1 Å

PDB Description: structure of inositol monophosphatase, the putative target of lithium therapy

SCOP Domain Sequences for d2hhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhma_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens)}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdde

SCOP Domain Coordinates for d2hhma_:

Click to download the PDB-style file with coordinates for d2hhma_.
(The format of our PDB-style files is described here.)

Timeline for d2hhma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hhmb_