Lineage for d1rdxb_ (1rdx B:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621435Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2621436Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2621437Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2621487Protein Fructose-1,6-bisphosphatase [56657] (7 species)
  7. 2621534Species Pig (Sus scrofa) [TaxId:9823] [56658] (65 PDB entries)
  8. 2621632Domain d1rdxb_: 1rdx B: [42933]
    complexed with f6p; mutant

Details for d1rdxb_

PDB Entry: 1rdx (more details), 2.75 Å

PDB Description: r-state structure of the arg 243 to ala mutant of pig kidney fructose 1,6-bisphosphatase expressed in e. coli
PDB Compounds: (B:) fructose 1,6-bisphosphatase

SCOPe Domain Sequences for d1rdxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdxb_ e.7.1.1 (B:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]}
tdqaafdtnivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygia
gstnvtgdqvkkldvlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpl
dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
vncfmldpaigefilvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
gaayvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
avldivptdihqrapiilgspedvtelleiyqkhaak

SCOPe Domain Coordinates for d1rdxb_:

Click to download the PDB-style file with coordinates for d1rdxb_.
(The format of our PDB-style files is described here.)

Timeline for d1rdxb_: