Lineage for d1eyjb_ (1eyj B:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266544Fold e.7: Sugar phosphatases [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 266545Superfamily e.7.1: Sugar phosphatases [56655] (1 family) (S)
  5. 266546Family e.7.1.1: Sugar phosphatases [56656] (6 proteins)
  6. 266574Protein Fructose-1,6-bisphosphatase [56657] (5 species)
  7. 266593Species Pig (Sus scrofa) [TaxId:9823] [56658] (33 PDB entries)
  8. 266615Domain d1eyjb_: 1eyj B: [42890]
    complexed with amp, f6p, mg, pi

Details for d1eyjb_

PDB Entry: 1eyj (more details), 2.28 Å

PDB Description: fructose-1,6-bisphosphatase complex with amp, magnesium, fructose-6- phosphate and phosphate (t-state)

SCOP Domain Sequences for d1eyjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyjb_ e.7.1.1 (B:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa)}
nivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgd
qvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidc
lvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldp
aigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsm
vadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivpt
dihqrapiilgspedvtelleiyqkha

SCOP Domain Coordinates for d1eyjb_:

Click to download the PDB-style file with coordinates for d1eyjb_.
(The format of our PDB-style files is described here.)

Timeline for d1eyjb_: