Lineage for d1egec2 (1ege C:10-241)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38059Fold e.6: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56644] (1 superfamily)
  4. 38060Superfamily e.6.1: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56645] (1 family) (S)
  5. 38061Family e.6.1.1: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56646] (3 proteins)
  6. 38072Protein Medium chain acyl-CoA dehydrogenase [56649] (2 species)
  7. 38073Species Human (Homo sapiens) [TaxId:9606] [56651] (3 PDB entries)
  8. 38084Domain d1egec2: 1ege C:10-241 [42867]
    Other proteins in same PDB: d1egea1, d1egeb1, d1egec1, d1eged1

Details for d1egec2

PDB Entry: 1ege (more details), 2.75 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase
PDB Compounds: (C:)

SCOP Domain Sequences for d1egec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egec2 e.6.1.1 (C:10-241) Medium chain acyl-CoA dehydrogenase {Human (Homo sapiens)}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOP Domain Coordinates for d1egec2:

Click to download the PDB-style file with coordinates for d1egec2.
(The format of our PDB-style files is described here.)

Timeline for d1egec2: