Lineage for d1egcc2 (1egc C:10-241)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451317Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1451318Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1451319Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 1451361Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)
  7. 1451362Species Human (Homo sapiens) [TaxId:9606] [56651] (5 PDB entries)
    Uniprot P11310 34-421
  8. 1451369Domain d1egcc2: 1egc C:10-241 [42863]
    Other proteins in same PDB: d1egca1, d1egcb1, d1egcc1, d1egcd1
    complexed with co8, fad; mutant

Details for d1egcc2

PDB Entry: 1egc (more details), 2.6 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase complexed with octanoyl-coa
PDB Compounds: (C:) medium chain acyl-coa dehydrogenase

SCOPe Domain Sequences for d1egcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egcc2 e.6.1.1 (C:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOPe Domain Coordinates for d1egcc2:

Click to download the PDB-style file with coordinates for d1egcc2.
(The format of our PDB-style files is described here.)

Timeline for d1egcc2: