SCOP 1.75: Domain d1egdd2: 1egd D:10-241

Lineage for d1egdd2 (1egd D:10-241)

1. Root: SCOP 1.75

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (9 proteins)

6. Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56651] (5 PDB entries)
   Uniprot P11310 34-421

8. Domain d1egdd2: 1egd D:10-241 [42860]
   Other proteins in same PDB: d1egda1, d1egdb1, d1egdc1, d1egdd1
   complexed with fad; mutant

Details for d1egdd2

PDB Entry: 1egd, 2.4 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase

PDB Compounds: (D:) medium chain acyl-coa dehydrogenase

SCOP Domain Sequences for d1egdd2:

Sequence; same for both SEQRES and ATOM records:

>d1egdd2 e.6.1.1 (D:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens) [TaxId: 9606]}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

Timeline for d1egdd2:

• d1egdd2 first appeared (with stable ids) in SCOP 1.55
  
• d1egdd2 appears in SCOP 1.73
  
• d1egdd2 appears in SCOPe 2.01
  
• d1egdd2 appears in the current release, SCOPe 2.08