Lineage for d3mdea2 (3mde A:11-241)

  1. Root: SCOP 1.69
  2. 517079Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)
  3. 517713Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 517714Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 517715Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (6 proteins)
  6. 517739Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (2 species)
  7. 517757Species Pig (Sus scrofa) [TaxId:9823] [56650] (3 PDB entries)
  8. 517760Domain d3mdea2: 3mde A:11-241 [42855]
    Other proteins in same PDB: d3mdea1, d3mdeb1

Details for d3mdea2

PDB Entry: 3mde (more details), 2.4 Å

PDB Description: crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate

SCOP Domain Sequences for d3mdea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdea2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa)}
gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltge

SCOP Domain Coordinates for d3mdea2:

Click to download the PDB-style file with coordinates for d3mdea2.
(The format of our PDB-style files is described here.)

Timeline for d3mdea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mdea1