Lineage for d3mddb2 (3mdd B:11-241)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38059Fold e.6: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56644] (1 superfamily)
  4. 38060Superfamily e.6.1: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56645] (1 family) (S)
  5. 38061Family e.6.1.1: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56646] (3 proteins)
  6. 38072Protein Medium chain acyl-CoA dehydrogenase [56649] (2 species)
  7. 38086Species Pig (Sus scrofa) [TaxId:9823] [56650] (2 PDB entries)
  8. 38088Domain d3mddb2: 3mdd B:11-241 [42854]
    Other proteins in same PDB: d3mdda1, d3mddb1

Details for d3mddb2

PDB Entry: 3mdd (more details), 2.4 Å

PDB Description: crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate
PDB Compounds: (B:)

SCOP Domain Sequences for d3mddb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mddb2 e.6.1.1 (B:11-241) Medium chain acyl-CoA dehydrogenase {Pig (Sus scrofa)}
gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltge

SCOP Domain Coordinates for d3mddb2:

Click to download the PDB-style file with coordinates for d3mddb2.
(The format of our PDB-style files is described here.)

Timeline for d3mddb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mddb1