Lineage for d3mdda2 (3mdd A:11-241)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451317Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1451318Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1451319Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)
  6. 1451361Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)
  7. 1451383Species Pig (Sus scrofa) [TaxId:9823] [56650] (3 PDB entries)
  8. 1451386Domain d3mdda2: 3mdd A:11-241 [42853]
    Other proteins in same PDB: d3mdda1, d3mddb1
    complexed with fad

Details for d3mdda2

PDB Entry: 3mdd (more details), 2.4 Å

PDB Description: crystal structures of medium chain acyl-coa dehydrogenase from pig liver mitochondria with and without substrate
PDB Compounds: (A:) medium chain acyl-coa dehydrogenase

SCOPe Domain Sequences for d3mdda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdda2 e.6.1.1 (A:11-241) Medium chain acyl-CoA dehydrogenase, NM domains {Pig (Sus scrofa) [TaxId: 9823]}
gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltge

SCOPe Domain Coordinates for d3mdda2:

Click to download the PDB-style file with coordinates for d3mdda2.
(The format of our PDB-style files is described here.)

Timeline for d3mdda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mdda1