Lineage for d1f4jc_ (1f4j C:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86569Fold e.5: Heme-linked catalases [56633] (1 superfamily)
  4. 86570Superfamily e.5.1: Heme-linked catalases [56634] (1 family) (S)
  5. 86571Family e.5.1.1: Heme-linked catalases [56635] (2 proteins)
  6. 86572Protein Catalase I [56636] (5 species)
  7. 86586Species Human (Homo sapiens) [TaxId:9606] [56638] (6 PDB entries)
  8. 86605Domain d1f4jc_: 1f4j C: [42800]

Details for d1f4jc_

PDB Entry: 1f4j (more details), 2.4 Å

PDB Description: structure of tetragonal crystals of human erythrocyte catalase

SCOP Domain Sequences for d1f4jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4jc_ e.5.1.1 (C:) Catalase I {Human (Homo sapiens)}
advlttgagnpvgdklnvitvgprgpllvqdvvftdemahfdreripervvhakgagafg
yfevthditkyskakvfehigkktpiavrfstvagesgsadtvrdprgfavkfytedgnw
dlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwdfwslrpeslhqvsflfsdr
gipdghrhmngygshtfklvnangeavyckfhyktdqgiknlsvedaarlsqedpdygir
dlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwphkdyplipvgklvlnrnpv
nyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrhrlgpnylhipvncpyrarv
anyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiqysgevrrfntanddnvtqv
rafyvnvlneeqrkrlceniaghlkdaqifiqkkavknftevhpdygshiqalldkynae
k

SCOP Domain Coordinates for d1f4jc_:

Click to download the PDB-style file with coordinates for d1f4jc_.
(The format of our PDB-style files is described here.)

Timeline for d1f4jc_: