Lineage for d1f4ja_ (1f4j A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015076Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 3015077Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 3015078Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 3015079Protein Catalase I [56636] (8 species)
  7. 3015120Species Human (Homo sapiens) [TaxId:9606] [56638] (6 PDB entries)
  8. 3015137Domain d1f4ja_: 1f4j A: [42798]
    complexed with hem

Details for d1f4ja_

PDB Entry: 1f4j (more details), 2.4 Å

PDB Description: structure of tetragonal crystals of human erythrocyte catalase
PDB Compounds: (A:) catalase

SCOPe Domain Sequences for d1f4ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4ja_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]}
advlttgagnpvgdklnvitvgprgpllvqdvvftdemahfdreripervvhakgagafg
yfevthditkyskakvfehigkktpiavrfstvagesgsadtvrdprgfavkfytedgnw
dlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwdfwslrpeslhqvsflfsdr
gipdghrhmngygshtfklvnangeavyckfhyktdqgiknlsvedaarlsqedpdygir
dlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwphkdyplipvgklvlnrnpv
nyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrhrlgpnylhipvncpyrarv
anyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiqysgevrrfntanddnvtqv
rafyvnvlneeqrkrlceniaghlkdaqifiqkkavknftevhpdygshiqalldkyna

SCOPe Domain Coordinates for d1f4ja_:

Click to download the PDB-style file with coordinates for d1f4ja_.
(The format of our PDB-style files is described here.)

Timeline for d1f4ja_: