Lineage for d1dgba_ (1dgb A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2245760Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2245761Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2245762Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 2245763Protein Catalase I [56636] (8 species)
  7. 2245804Species Human (Homo sapiens) [TaxId:9606] [56638] (6 PDB entries)
  8. 2245817Domain d1dgba_: 1dgb A: [42794]
    complexed with hem, ndp

Details for d1dgba_

PDB Entry: 1dgb (more details), 2.2 Å

PDB Description: human erythrocyte catalase
PDB Compounds: (A:) catalase

SCOPe Domain Sequences for d1dgba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgba_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]}
srdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemah
fdreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsa
dtvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvw
dfwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgik
nlsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvw
phkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthr
hrlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsi
qysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknft
evhpdygshiqalldkyn

SCOPe Domain Coordinates for d1dgba_:

Click to download the PDB-style file with coordinates for d1dgba_.
(The format of our PDB-style files is described here.)

Timeline for d1dgba_: