Lineage for d1dgha_ (1dgh A:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37972Fold e.5: Heme-linked catalases [56633] (1 superfamily)
  4. 37973Superfamily e.5.1: Heme-linked catalases [56634] (1 family) (S)
  5. 37974Family e.5.1.1: Heme-linked catalases [56635] (2 proteins)
  6. 37975Protein Catalase I [56636] (5 species)
  7. 37989Species Human (Homo sapiens) [TaxId:9606] [56638] (6 PDB entries)
  8. 37998Domain d1dgha_: 1dgh A: [42790]

Details for d1dgha_

PDB Entry: 1dgh (more details), 2 Å

PDB Description: human erythrocyte catalase 3-amino-1,2,4-triazole complex

SCOP Domain Sequences for d1dgha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgha_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens)}
rdpasdqmqhwkeqraaqkadvlttgagnpvgdklnvitvgprgpllvqdvvftdemahf
dreripervvhakgagafgyfevthditkyskakvfehigkktpiavrfstvagesgsad
tvrdprgfavkfytedgnwdlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwd
fwslrpeslhqvsflfsdrgipdghrhmngygshtfklvnangeavyckfhyktdqgikn
lsvedaarlsqedpdygirdlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwp
hkdyplipvgklvlnrnpvnyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrh
rlgpnylhipvncpyrarvanyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiq
ysgevrrfntanddnvtqvrafyvnvlneeqrkrlceniaghlkdaqifiqkkavknfte
vhpdygshiqalldkyn

SCOP Domain Coordinates for d1dgha_:

Click to download the PDB-style file with coordinates for d1dgha_.
(The format of our PDB-style files is described here.)

Timeline for d1dgha_: