Lineage for d4blcc_ (4blc C:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37972Fold e.5: Heme-linked catalases [56633] (1 superfamily)
  4. 37973Superfamily e.5.1: Heme-linked catalases [56634] (1 family) (S)
  5. 37974Family e.5.1.1: Heme-linked catalases [56635] (2 proteins)
  6. 37975Protein Catalase I [56636] (5 species)
  7. 37981Species Cow (Bos taurus) [TaxId:9913] [56637] (3 PDB entries)
  8. 37984Domain d4blcc_: 4blc C: [42777]

Details for d4blcc_

PDB Entry: 4blc (more details), 2.3 Å

PDB Description: the structure of orthorhombic crystals of beef liver catalase

SCOP Domain Sequences for d4blcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4blcc_ e.5.1.1 (C:) Catalase I {Cow (Bos taurus)}
nrdpasdqmkhwkeqraaqkpdvlttgggnpvgdklnsltvgprgpllvqdvvftdemah
fdreripervvhakgagafgyfevthditryskakvfehigkrtpiavrfstvagesgsa
dtvrdprgfavkfytedgnwdlvgnntpiffirdallfpsfihsqkrnpqthlkdpdmvw
dfwslrpeslhqvsflfsdrgipdghrhmdgygshtfklvnadgeavyckfhyktdqgik
nlsvedaarlahedpdyglrdlfnaiatgnypswtlyiqvmtfseaeifpfnpfdltkvw
phgdyplipvgklvlnrnpvnyfaeveqlafdpsnmppgiepspdkmlqgrlfaypdthr
hrlgpnylqipvncpyrarvanyqrdgpmcmmdnqggapnyypnsfsapehqpsalehrt
hfsgdvqrfnsanddnvtqvrtfylkvlneeqrkrlceniaghlkdaqlfiqkkavknfs
dvhpeygsriqalldkyne

SCOP Domain Coordinates for d4blcc_:

Click to download the PDB-style file with coordinates for d4blcc_.
(The format of our PDB-style files is described here.)

Timeline for d4blcc_: