Lineage for d1lbea_ (1lbe A:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86562Fold e.4: ADP ribosyl cyclase [56628] (1 superfamily)
  4. 86563Superfamily e.4.1: ADP ribosyl cyclase [56629] (1 family) (S)
  5. 86564Family e.4.1.1: ADP ribosyl cyclase [56630] (1 protein)
  6. 86565Protein ADP ribosyl cyclase [56631] (1 species)
  7. 86566Species Sea hare (Aplysia californica) [TaxId:6500] [56632] (1 PDB entry)
  8. 86567Domain d1lbea_: 1lbe A: [42773]

Details for d1lbea_

PDB Entry: 1lbe (more details), 2.4 Å

PDB Description: aplysia adp ribosyl cyclase

SCOP Domain Sequences for d1lbea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lbea_ e.4.1.1 (A:) ADP ribosyl cyclase {Sea hare (Aplysia californica)}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrl

SCOP Domain Coordinates for d1lbea_:

Click to download the PDB-style file with coordinates for d1lbea_.
(The format of our PDB-style files is described here.)

Timeline for d1lbea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lbeb_