Lineage for d1ei5a3 (1ei5 A:3-335)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2619091Protein D-aminopeptidase, N-terminal domain [56626] (1 species)
  7. 2619092Species Ochrobactrum anthropi [TaxId:529] [56627] (1 PDB entry)
  8. 2619093Domain d1ei5a3: 1ei5 A:3-335 [42772]
    Other proteins in same PDB: d1ei5a1, d1ei5a2

Details for d1ei5a3

PDB Entry: 1ei5 (more details), 1.9 Å

PDB Description: crystal structure of a d-aminopeptidase from ochrobactrum anthropi
PDB Compounds: (A:) d-aminopeptidase

SCOPe Domain Sequences for d1ei5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ei5a3 e.3.1.1 (A:3-335) D-aminopeptidase, N-terminal domain {Ochrobactrum anthropi [TaxId: 529]}
kfdtsaleafvrhipqnykgpggvvavvkdgevvlqhawgfadlrtrtpmtldtrmpics
vskqftcavlldavgepellddaleayldkfederpavrdlcnnqsglrdywalsvlcga
dpegvflpaqaqsllrrlktthfepgshysycngnfriladlieahtgrtlvdilserif
apagmkraelisdtalfdectgyegdtvrgflpatnriqwmgdagicaslndmiaweqfi
datrddesglyrrlsgpqtfkdgvaapygfglnlhetggkrltghggalrgwrcqrwhca
derlstiamfnfeggasevafklmnialgvsss

SCOPe Domain Coordinates for d1ei5a3:

Click to download the PDB-style file with coordinates for d1ei5a3.
(The format of our PDB-style files is described here.)

Timeline for d1ei5a3: