Lineage for d1fofa_ (1fof A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2618349Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2618350Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2618351Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2618910Protein Class D beta-lactamase [56622] (4 species)
  7. 2618924Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (33 PDB entries)
  8. 2618961Domain d1fofa_: 1fof A: [42763]
    complexed with co, so4

Details for d1fofa_

PDB Entry: 1fof (more details), 2 Å

PDB Description: crystal structure of the class d beta-lactamase oxa-10
PDB Compounds: (A:) beta lactamase oxa-10

SCOPe Domain Sequences for d1fofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fofa_ e.3.1.1 (A:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
gsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigle
tgviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkf
sygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaape
ylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkime
segiig

SCOPe Domain Coordinates for d1fofa_:

Click to download the PDB-style file with coordinates for d1fofa_.
(The format of our PDB-style files is described here.)

Timeline for d1fofa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fofb_