Lineage for d1e4dc_ (1e4d C:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450418Protein Class D beta-lactamase [56622] (4 species)
  7. 1450432Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (25 PDB entries)
  8. 1450459Domain d1e4dc_: 1e4d C: [42761]
    complexed with edo, so4

Details for d1e4dc_

PDB Entry: 1e4d (more details), 1.8 Å

PDB Description: structure of oxa10 beta-lactamase at ph 8.3
PDB Compounds: (C:) beta-lactamase oxa-10

SCOPe Domain Sequences for d1e4dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4dc_ e.3.1.1 (C:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
egiigg

SCOPe Domain Coordinates for d1e4dc_:

Click to download the PDB-style file with coordinates for d1e4dc_.
(The format of our PDB-style files is described here.)

Timeline for d1e4dc_: