Lineage for d1fcna_ (1fcn A:)

  1. Root: SCOP 1.57
  2. 86313Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)
  3. 86412Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 86413Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 86414Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 86415Protein AMPC beta-Lactamase, class C [56618] (3 species)
  7. 86428Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (12 PDB entries)
  8. 86449Domain d1fcna_: 1fcn A: [42751]

Details for d1fcna_

PDB Entry: 1fcn (more details), 2.35 Å

PDB Description: crystal structure of the e. coli ampc beta-lactamase mutant q120l/y150e covalently acylated with the substrate beta-lactam loracarbef

SCOP Domain Sequences for d1fcna_:

Sequence, based on SEQRES records: (download)

>d1fcna_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglpllvpd
evksssdllrfyqnwqpawapgtqrleanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Sequence, based on observed residues (ATOM records): (download)

>d1fcna_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglpllvpd
evksssdllrfyqnwqpawapgtqrleanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiiialaarpvkaitpptpavr
aswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOP Domain Coordinates for d1fcna_:

Click to download the PDB-style file with coordinates for d1fcna_.
(The format of our PDB-style files is described here.)

Timeline for d1fcna_: