SCOP 1.57: Domain d1fcob_: 1fco B:

Lineage for d1fcob_ (1fco B:)

1. Root: SCOP 1.57

2. Class e: Multi-domain proteins (alpha and beta) [56572] (32 folds)

3. Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)

4. Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (12 PDB entries)

8. Domain d1fcob_: 1fco B: [42750]

Details for d1fcob_

PDB Entry: 1fco, 2.2 Å

PDB Description: crystal structure of the e. coli ampc beta-lactamase covalently acylated with the inhibitory beta-lactam, moxalactam

SCOP Domain Sequences for d1fcob_:

Sequence; same for both SEQRES and ATOM records:

>d1fcob_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1fcob_:

• d1fcob_ first appeared (with stable ids) in SCOP 1.55
  
• d1fcob_ appears in SCOP 1.59
  
• d1fcob_ appears in the current release, SCOPe 2.08