Lineage for d3blsa_ (3bls A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450076Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 1450095Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (73 PDB entries)
  8. 1450224Domain d3blsa_: 3bls A: [42745]
    complexed with apb

Details for d3blsa_

PDB Entry: 3bls (more details), 2.3 Å

PDB Description: ampc beta-lactamase from escherichia coli
PDB Compounds: (A:) ampc beta-lactamase

SCOPe Domain Sequences for d3blsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3blsa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnal

SCOPe Domain Coordinates for d3blsa_:

Click to download the PDB-style file with coordinates for d3blsa_.
(The format of our PDB-style files is described here.)

Timeline for d3blsa_: