Lineage for d3blsa_ (3bls A:)
- Root: SCOP 1.59
Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein AMPC beta-Lactamase, class C [56618] (3 species) 
Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (12 PDB entries) 
Domain d3blsa_: 3bls A: [42745]
Details for d3blsa_
PDB Entry: 3bls (more details), 2.3 Å
PDB Description: ampc beta-lactamase from escherichia coli
SCOP Domain Sequences for d3blsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3blsa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnal
SCOP Domain Coordinates for d3blsa_:
Click to download the PDB-style file with coordinates for d3blsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3blsa_:
- d3blsa_ first appeared (with stable ids) in SCOP 1.55
- d3blsa_ appears in SCOP 1.57
- d3blsa_ appears in SCOP 1.61
- d3blsa_ appears in the current release, SCOPe 2.08
View in 3D
