![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
![]() | Protein AMPC beta-Lactamase, class C [56618] (4 species) contains small alpha+beta subdomain inserted in the common fold |
![]() | Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (101 PDB entries) |
![]() | Domain d1c3bb_: 1c3b B: [42744] complexed with bzb |
PDB Entry: 1c3b (more details), 2.25 Å
SCOPe Domain Sequences for d1c3bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3bb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
Timeline for d1c3bb_: