SCOPe 2.05: Domain d1c3ba_: 1c3b A:

Lineage for d1c3ba_ (1c3b A:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (97 PDB entries)

8. Domain d1c3ba_: 1c3b A: [42743]
   complexed with bzb

Details for d1c3ba_

PDB Entry: 1c3b, 2.25 Å

PDB Description: ampc beta-lactamase from e. coli complexed with inhibitor, benzo(b)thiophene-2-boronic acid (bzb)

PDB Compounds: (A:) cephalosporinase

SCOPe Domain Sequences for d1c3ba_:

Sequence; same for both SEQRES and ATOM records:

>d1c3ba_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1c3ba_:

• d1c3ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1c3ba_ appears in SCOPe 2.04
  
• d1c3ba_ appears in SCOPe 2.06
  
• d1c3ba_ appears in the current release, SCOPe 2.08