Lineage for d1dy6b_ (1dy6 B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054569Protein beta-Lactamase, class A [56606] (15 species)
  7. 1054687Species Serratia marcescens, Sme-1 [TaxId:615] [56617] (1 PDB entry)
    imipenem-hydrolyzing
  8. 1054689Domain d1dy6b_: 1dy6 B: [42733]

Details for d1dy6b_

PDB Entry: 1dy6 (more details), 2.1 Å

PDB Description: structure of the imipenem-hydrolyzing beta-lactamase sme-1
PDB Compounds: (B:) carbapenem-hydrolysing beta-lactamase sme-1

SCOPe Domain Sequences for d1dy6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dy6b_ e.3.1.1 (B:) beta-Lactamase, class A {Serratia marcescens, Sme-1 [TaxId: 615]}
nksdaaakqikkleedfdgrigvfaidtgsgntfgyrsderfplcssfkgflaaavlerv
qqkkldinqkvkyesrdleyhspittkykgsgmtlgdmasaalqysdngatniimerflg
gpegmtkfmrsigdnefrldrwelelntaipgdkrdtstpkavanslnklalgnvlnakv
kaiyqnwlkgnttgdarirasvpadwvvgdktgscgaygtandyaviwpknraplivsiy
ttrkskddkhsdktiaeasriaiqaid

SCOPe Domain Coordinates for d1dy6b_:

Click to download the PDB-style file with coordinates for d1dy6b_.
(The format of our PDB-style files is described here.)

Timeline for d1dy6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dy6a_