Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein beta-Lactamase, class A [56606] (16 species) |
Species Bacillus licheniformis [TaxId:1402] [56612] (14 PDB entries) |
Domain d2blmb_: 2blm B: [42726] CA-atoms only |
PDB Entry: 2blm (more details), 2 Å
SCOPe Domain Sequences for d2blmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2blmb_ e.3.1.1 (B:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]} ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr kigdevtnperfepelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd dkliaeatkvvmkalnmngk
Timeline for d2blmb_: