Lineage for d1mblb_ (1mbl B:)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins) 
Protein beta-Lactamase, class A [56606] (11 species) 
Species Bacillus licheniformis [TaxId:1402] [56612] (3 PDB entries) 
Domain d1mblb_: 1mbl B: [42724]
Details for d1mblb_
PDB Entry: 1mbl (more details), 2 Å
PDB Description: a catalytically-impaired class a beta-lactamase: 2 angstroms crystal structure and kinetics of the bacillus licheniformis e166a mutant
SCOP Domain Sequences for d1mblb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mblb_ e.3.1.1 (B:) beta-Lactamase, class A {Bacillus licheniformis}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfapelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln
SCOP Domain Coordinates for d1mblb_:
Click to download the PDB-style file with coordinates for d1mblb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mblb_:
- d1mblb_ appears in SCOP 1.57
- d1mblb_ appears in the current release, SCOPe 2.08
View in 3D
