Lineage for d4blmb_ (4blm B:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 338664Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 338665Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 338666Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)
  6. 338739Protein beta-Lactamase, class A [56606] (14 species)
  7. 338740Species Bacillus licheniformis [TaxId:1402] [56612] (5 PDB entries)
  8. 338742Domain d4blmb_: 4blm B: [42722]

Details for d4blmb_

PDB Entry: 4blm (more details), 2 Å

PDB Description: beta-lactamase of bacillus licheniformis 749(slash)c. refinement at 2 angstroms resolution and analysis of hydration

SCOP Domain Sequences for d4blmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4blmb_ e.3.1.1 (B:) beta-Lactamase, class A {Bacillus licheniformis}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

SCOP Domain Coordinates for d4blmb_:

Click to download the PDB-style file with coordinates for d4blmb_.
(The format of our PDB-style files is described here.)

Timeline for d4blmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4blma_